PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493566.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 450aa    MW: 49296.2 Da    PI: 5.5719
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493566.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-163781147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++v+a k++G   W+ I +++g ++t+ q++s+ qk+
   XP_016493566.1 37 REKWTEEEHQRFVEALKLYGRA-WRQIEEHVG-TKTAIQIRSHAQKF 81
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.68E-163185IPR009057Homeodomain-like
PROSITE profilePS5129421.9713286IPR017930Myb domain
TIGRFAMsTIGR015579.3E-173584IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.8E-93677IPR009057Homeodomain-like
SMARTSM007171.0E-123684IPR001005SANT/Myb domain
PfamPF002492.4E-133780IPR001005SANT/Myb domain
CDDcd001671.00E-93982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MISSKLETVA TQGKALTCLA NEITLKVRKP YTITKQREKW TEEEHQRFVE ALKLYGRAWR  60
QIEEHVGTKT AIQIRSHAQK FFAKVARDSG TDGDESLNAI DIPPPRPKKK PLHPYPRKMA  120
DSPVTNKSVS GQPERSSPPN ASGRDSCSPD SVLSEIGSDV SEYLVAEQQS SRFSPYSCTT  180
DAHAANIISG QNGDESMTSK SNIVKEIPVA SKPVAASSSS IFNSGMECDF VPRETSFPGE  240
KLAVEAPLAS IKLFGQMVLV PDATKLALQS PAGSCNSLPS KTTENEIETN NGNVIHGFQA  300
NSQFILPVVP GNMIPSACWL SQDMLENNPE GVAAFPTTIP WLSWYQDLVY RYISLCSQTA  360
AETTTLCRRP EDEEPQREGS SSGLSVGSAS EVDDGNRSSE TVESKYTTKS DKWNNIKGFV  420
PYKRCLAERD GMSSGVELEE RESQRVRVCS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768903.10.0PREDICTED: uncharacterized protein LOC104219851 isoform X1
RefseqXP_016493565.10.0PREDICTED: uncharacterized protein LOC107812899 isoform X1
TrEMBLM1CEP70.0M1CEP7_SOLTU; Uncharacterized protein
TrEMBLM1CEP80.0M1CEP8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000658500.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.13e-38MYB_related family protein